PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B01869.1.p
Common NameEUGRSUZ_B01869
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 197aa    MW: 22918.8 Da    PI: 10.2362
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B01869.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding65.59.9e-211562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+eEd++l+++++ +G+++Wk++a++ g++R++k+c++rw++yl
  Eucgr.B01869.1.p 15 RGAWTPEEDQKLAQVIETHGPKRWKLVAAKAGLNRCGKSCRLRWLNYL 62
                      89********************************************97 PP

2Myb_DNA-binding506.6e-1668113148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+ + +E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
  Eucgr.B01869.1.p  68 RGNISDQEEDLILRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 113
                       78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.1661066IPR017930Myb domain
SMARTSM007172.6E-171464IPR001005SANT/Myb domain
SuperFamilySSF466891.3E-2914109IPR009057Homeodomain-like
PfamPF002493.7E-201562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-261669IPR009057Homeodomain-like
CDDcd001674.92E-121762No hitNo description
SMARTSM007173.1E-1567115IPR001005SANT/Myb domain
PROSITE profilePS5129420.89667117IPR017930Myb domain
PfamPF002491.8E-1468113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-2570118IPR009057Homeodomain-like
CDDcd001678.11E-1072113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MAPTRSRYSK REANRGAWTP EEDQKLAQVI ETHGPKRWKL VAAKAGLNRC GKSCRLRWLN  60
YLRPNIKRGN ISDQEEDLIL RLHRLLGNRW SLIAGRLPGR TDNEIKNYWN SHLSKKIKQK  120
ENQSKSPEQD QSQDLRNSAA RMHSMVGNNG ETSKRDEVMK TDFSRNEILD SFDEGPLNLE  180
WMSRFLEMDE SWFSFA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-30121171105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B01869.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010042989.11e-144PREDICTED: transcription factor MYB114-like
SwissprotP102904e-52MYBC_MAIZE; Anthocyanin regulatory C1 protein
SwissprotQ9SEI01e-52WER_ARATH; Transcription factor WER
TrEMBLA0A059D4B11e-144A0A059D4B1_EUCGR; Uncharacterized protein
STRINGVIT_04s0008g01870.t012e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.18e-54myb domain protein 66